CCL4_MOUSE   P14097


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P14097

Recommended name:C-C motif chemokine 4

EC number:

Alternative names:(Immune activation protein 2) (ACT-2) (ACT2) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4)

Cleaved into:

GeneID:20303

Gene names  (primary ):Ccl4

Gene names  (synonym ):Mip1b Scya4

Gene names  (ORF ):

Length:92

Mass:10168

Sequence:MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp