IL5_MOUSE P04401
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04401
Recommended name：Interleukin-5
EC number：
Alternative names：(IL-5) (B-cell growth factor II) (BCGF-II) (Cytotoxic T-lymphocyte inducer) (Eosinophil differentiation factor) (T-cell replacing factor) (TRF)
Cleaved into：
GeneID：16191
Gene names (primary )：Il5
Gene names (synonym )：Il-5
Gene names (ORF )：
Length：133
Mass：15410
Sequence：MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Tissue specificity：
Induction：
Developmental stage：
Protein families：IL-5 family