IL4_MOUSE P07750
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07750
Recommended name：Interleukin-4
EC number：
Alternative names：(IL-4) (B-cell IgG differentiation factor) (B-cell growth factor 1) (B-cell stimulatory factor 1) (BSF-1) (IGG1 induction factor) (Lymphocyte stimulatory factor 1)
Cleaved into：
GeneID：16189
Gene names (primary )：Il4
Gene names (synonym )：Il-4
Gene names (ORF )：
Length：140
Mass：15834
Sequence：MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Tissue specificity：
Induction：
Developmental stage：
Protein families：IL-4/IL-13 family