I18BP_MOUSE   Q9Z0M9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z0M9

Recommended name:Interleukin-18-binding protein

EC number:

Alternative names:(IL-18BP) (Interferon gamma-inducing factor-binding protein)

Cleaved into:

GeneID:16068

Gene names  (primary ):Il18bp

Gene names  (synonym ):Igifbp

Gene names  (ORF ):

Length:193

Mass:21257

Sequence:MTMRHCWTAGPSSWWVLLLYVHVILARATSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp