IKZF5_MOUSE   Q8BU00


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BU00

Recommended name:Zinc finger protein Pegasus

EC number:

Alternative names:(Ikaros family zinc finger protein 5)

Cleaved into:

GeneID:67143

Gene names  (primary ):Ikzf5

Gene names  (synonym ):Zfpn1a5 Znfn1a5

Gene names  (ORF ):

Length:419

Mass:46400

Sequence:MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAETLQGAGTDGDQNGLDHPSVEVSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASAYERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYEAMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVDACPDEKPFMIQQPSAQAVVSAVSASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPTLPVQDPQLLHHCQHCDVYFADNVLYTVHMGCHGYDSPFQCNVCGCKCKDKYDFACHFARGQHNQH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ikaros C2H2-type zinc-finger protein family


   💬 WhatsApp