FAIM3_MOUSE   A1KXC4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A1KXC4

Recommended name:Fas apoptotic inhibitory molecule 3

EC number:

Alternative names:(IgM Fc fragment receptor) (Regulator of Fas-induced apoptosis Toso)

Cleaved into:

GeneID:69169

Gene names  (primary ):Fcmr

Gene names  (synonym ):Faim3 Toso

Gene names  (ORF ):

Length:422

Mass:47471

Sequence:MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRLAMRRRGRGASRPFPTQRRDASQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASPASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDDYINIPDPSHLPSYAPGPRSSCP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp