IBPL1_MOUSE   Q80W15


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80W15

Recommended name:Insulin-like growth factor-binding protein-like 1

EC number:

Alternative names:(IGFBP-related protein 10) (Insulin-like growth factor-binding-related protein 4) (IGFBP-rP4)

Cleaved into:

GeneID:75426

Gene names  (primary ):Igfbpl1

Gene names  (synonym ):Igfbprp4

Gene names  (ORF ):

Length:270

Mass:28573

Sequence:MPRLPLLLLLLPSLARGLGLRDAGRRHPECSPCQQDRCPAPSPCPAPWISARDECGCCARCLGAEGASCGGPVGSRCGPGLVCASRASGTAPEGTGLCVCAQRGAVCGSDGRSYSSICALRLRARHAPRAHHGHLHKARDGPCEFAPVVLMPPRDIHNVTGTQVFLSCEVKAVPTPVITWKKVKHSPEGTEGLEELPGDHVNIAVQVRGGPSDHETTSWILINPLRKEDEGVYHCHAANAIGEAQSHGTVTVLDLNRYKSLYSSVPGDLL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp