HVM49_MOUSE P06328
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P06328
Recommended name:Ig heavy chain V region 1-72
EC number:
Alternative names:(Ig heavy chain V region VH558 B4)
Cleaved into:
GeneID:
Gene names (primary ):Ighv1-72
Gene names (synonym ):
Gene names (ORF ):
Length:117
Mass:12877
Sequence:MGWSCIMLFLAATATGVHSQVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCAR
Tissue specificity:
Induction:
Developmental stage:
Protein families: