H1BP3_MOUSE   Q3TC93


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TC93

Recommended name:HCLS1-binding protein 3

EC number:

Alternative names:(HS1-binding protein 3) (HSP1BP-3)

Cleaved into:

GeneID:58240

Gene names  (primary ):Hs1bp3

Gene names  (synonym ):

Gene names  (ORF ):

Length:395

Mass:43691

Sequence:MQSPAVLRTSRQVQNAHTGLDLSVPQHQEVRGKMMSGHVEYQILVVTRLAVFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLYSCYPAASLPPLPRKVLFVGESDIRERRAMFDEILRCVSKDAQLAGSPELLEFLGTRAPGATGLATRDPSVLDDTASQPGDSDEAFDFFEQQDEVQPPTLGLSSKDVEKSLVGEEEEEEEEEEVLDPLGIMRSKKPKKRPEVAVRPKPAPRLTIFDEEVDPDAGLFSSDKKVSETRRPLETTQDSLKLFDDPDLGGAVSLGDPLLLPAASESRGPTSRPEHGDASKELFRVEEDLDLILNLGSEPKPKPQTKPKPLVPAKPALPRKPTLPASVGPSEPGSGPQKQQQIQAMDEMDILQYIRDHDTLAQDSPSLF

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:10590261}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp