HPGDS_MOUSE   Q9JHF7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHF7

Recommended name:Hematopoietic prostaglandin D synthase

EC number:EC 5.3.99.2

Alternative names:(H-PGDS) (GST class-sigma) (Glutathione S-transferase) (Glutathione-dependent PGD synthase) (Glutathione-requiring prostaglandin D synthase) (Prostaglandin-H2 D-isomerase)

Cleaved into:

GeneID:54486

Gene names  (primary ):Hpgds

Gene names  (synonym ):Gsts Pgds Ptgds2

Gene names  (ORF ):

Length:199

Mass:23227

Sequence:MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL

Tissue specificity:Expressed in skin and oviduct. {ECO:0000269|PubMed:10824118}.

Induction:

Developmental stage:

Protein families:GST superfamily, Sigma family


   💬 WhatsApp