IRX4_MOUSE   Q9QY61


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QY61

Recommended name:Iroquois-class homeodomain protein IRX-4

EC number:

Alternative names:(Homeodomain protein IRXA3) (Iroquois homeobox protein 4)

Cleaved into:

GeneID:50916

Gene names  (primary ):Irx4

Gene names  (synonym ):Irxa3

Gene names  (ORF ):

Length:515

Mass:54701

Sequence:MSYPQFGYPYSSAPQFLMTTNSLSTCCESGGRTLADSGPAASAQAPVYCPVYESRLLATARHELNSAAALGVYGSPYGSSQGYGNYVTYGSEASAFYSLNSFESKDGTGSSHAGLPPTAAAAYYPYEPALSQYPYDRYGTVDSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKCADEKRPYGEGEEEEAGEEESREEPLKSAKSEGHAGKDDKELELSDLEDFDPLDAETSECELKTPFQSLDSGPERIPASSDGPGTGKEASTTLRMPLGTAGGAVMDGDLERARNCLRSTVVVPDSGAEGGPPACEAKLTFAQAGAPPNLETKPRIWSLAHTATAAAATALSQTEFPSCMLKRQGPTGVSATTPASSPAVTAPSGALDRHQDSPVTSLRNWVDGVFHDPILRHSTLNQAWATAKGALLDPGPLGRNLGAGTNVLTTPLACSFPPTVPQDVPPAGASRELLATPKAGGKPFCT

Tissue specificity:Expressed in the developing central nervous system, skin, and vibrissae, but predominantly expressed in the cardiac ventricles of the developing heart. Not expressed in the developing metanephric kidney or adult kidney. {ECO:0000269|PubMed:10625552, ECO:0000269|PubMed:10926765}.

Induction:

Developmental stage:

Protein families:TALE/IRO homeobox family


   💬 WhatsApp