HXB7_MOUSE   P09024


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09024

Recommended name:Homeobox protein Hox-B7

EC number:

Alternative names:(Homeobox protein Hox-2.3) (Homeobox protein MH-22B) (Homeobox protein MuB1)

Cleaved into:

GeneID:15415

Gene names  (primary ):Hoxb7

Gene names  (synonym ):Hox-2.3 Hoxb-7

Gene names  (ORF ):

Length:217

Mass:23967

Sequence:MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEEEEEE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Antp homeobox family


   💬 WhatsApp