HNRDL_MOUSE   Q9Z130


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z130

Recommended name:Heterogeneous nuclear ribonucleoprotein D-like

EC number:

Alternative names:(hnRNP D-like) (hnRNP DL) (JKT41-binding protein)

Cleaved into:

GeneID:

Gene names  (primary ):Hnrnpdl

Gene names  (synonym ):Hnrpdl Jktbp

Gene names  (ORF ):

Length:301

Mass:33559

Sequence:MEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGARGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY

Tissue specificity:Expressed in skeletal muscle, myoblast, myotube, heart, brain, liver, kidney, heart, lung, stomach, small intestine, large intestine, spleen, and testis (at protein level). Expressed in brain, skeletal muscle, heart, lung, liver, stomach, small intestine, large intestine, kidney, spleen and testis. {ECO:0000269|PubMed:10717477}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp