HMGB1_MOUSE   P63158


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63158

Recommended name:High mobility group protein B1

EC number:

Alternative names:(High mobility group protein 1) (HMG-1)

Cleaved into:

GeneID:15289

Gene names  (primary ):Hmgb1

Gene names  (synonym ):Hmg-1 Hmg1

Gene names  (ORF ):

Length:215

Mass:24894

Sequence:MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Tissue specificity:Serum levels are found elevated in mice with modeled systemic lupus erythematosus (SLE) and are correlated with SLE disease activity (PubMed:26078984). {ECO:0000269|PubMed:26078984}.

Induction:

Developmental stage:

Protein families:HMGB family


   💬 WhatsApp