CC85B_MOUSE   Q6PDY0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PDY0

Recommended name:Coiled-coil domain-containing protein 85B

EC number:

Alternative names:(Hepatitis delta antigen-interacting protein A homolog) (Delta-interacting protein A homolog)

Cleaved into:

GeneID:240514

Gene names  (primary ):Ccdc85b

Gene names  (synonym ):Dipa

Gene names  (ORF ):

Length:202

Mass:22133

Sequence:MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPGGAVGSGAGPTPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD

Tissue specificity:Expressed in white and brown adipose tissue. {ECO:0000269|PubMed:15644333}.

Induction:

Developmental stage:

Protein families:CCDC85 family


   💬 WhatsApp