HOIL1_MOUSE   Q9WUB0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WUB0

Recommended name:RanBP-type and C3HC4-type zinc finger-containing protein 1

EC number:EC 2.3.2.31

Alternative names:(Heme-oxidized IRP2 ubiquitin ligase 1 homolog) (HOIL-1) (RING-type E3 ubiquitin transferase HOIL-1) (UbcM4-interacting protein 28) (Ubiquitin-conjugating enzyme 7-interacting protein 3)

Cleaved into:

GeneID:24105

Gene names  (primary ):Rbck1

Gene names  (synonym ):Rbck Ubce7ip3 Uip28

Gene names  (ORF ):

Length:508

Mass:57534

Sequence:MDEKTKKAEEMALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH

Tissue specificity:

Induction:

Developmental stage:

Protein families:RBR family


   💬 WhatsApp