RIDA_MOUSE   P52760


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52760

Recommended name:2-iminobutanoate/2-iminopropanoate deaminase

EC number:EC 3.5.99.10

Alternative names:(Heat-responsive protein 12) (Reactive intermediate imine deaminase A homolog) (Translation inhibitor L-PSP ribonuclease)

Cleaved into:

GeneID:15473

Gene names  (primary ):Rida

Gene names  (synonym ):Hrp12

Gene names  (ORF ):

Length:135

Mass:14255

Sequence:MSSIIRKVISTTKAPAAIGPYSQAVQVDRTIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEILKAAGCDFNNVVKTTVLLADMNDFGTVNEIYKTYFQGSLPARAAYQVAALPRGSRVEIEAIAVQGPFIKA

Tissue specificity:Expressed predominantly in liver and kidney. Lower levels in lung and brain. {ECO:0000269|PubMed:9141440}.

Induction:

Developmental stage:

Protein families:RutC family


   💬 WhatsApp