HARB1_MOUSE   Q8BR93


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BR93

Recommended name:Putative nuclease HARBI1

EC number:EC 3.1.-.-

Alternative names:(Harbinger transposase-derived nuclease)

Cleaved into:

GeneID:241547

Gene names  (primary ):Harbi1

Gene names  (synonym ):

Gene names  (ORF ):

Length:349

Mass:38713

Sequence:MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYFLVELLGASLSRPTQRSRAISPETQILAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIHFPVDEAAVQSLKDEFYGLAGMPGVIGVADCIHVAIKAPNAEDLSYVNRKGLHSLNCLVVCDIRGALMTVETSWPGSLQDCAVLQRSSLTSQFETGMPKDSWLLGDSSFFLRSWLLTPLPIPETAAEYRYNRAHSATHSVIERTLQTLCCRFRCLDGSKGALQYSPEKCSHIILACCVLHNISLDHGMDVWSSPVPGPIDQPPEGEDEHMESLDLEADRIRQELILTHFS

Tissue specificity:Detected in adult brain, eye, nerve tissue and lung. Detected in embryo. {ECO:0000269|PubMed:15169610}.

Induction:

Developmental stage:

Protein families:HARBI1 family


   💬 WhatsApp