H2A2B_MOUSE Q64522
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64522
Recommended name：Histone H2A type 2-B
EC number：
Alternative names：(H2A-clustered histone 21) (H2a-613A)
Cleaved into：
GeneID：621893
Gene names (primary )：H2ac21
Gene names (synonym )：Hist2h2ab
Gene names (ORF )：
Length：130
Mass：14013
Sequence：MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2A family