GUC2A_MOUSE   P33680


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P33680

Recommended name:Guanylin

EC number:

Alternative names:(Guanylate cyclase activator 2A)

Cleaved into:

GeneID:14915

Gene names  (primary ):Guca2a

Gene names  (synonym ):Guca2

Gene names  (ORF ):

Length:116

Mass:12467

Sequence:MNACVLSVLCLLGALAVLVEGVTVQDGDLSFPLESVKKLKGLREVQEPRLVSHKKFAPRLLQPVAPQLCSSHSALPEALRPVCEKPNAEEILQRLEAIAQDPNTCEICAYAACTGC

Tissue specificity:Localized in both crypts and villi in the small intestine and to superficial epithelial cells in the colon.

Induction:

Developmental stage:

Protein families:Guanylin family


   💬 WhatsApp