GTPB3_MOUSE   Q923K4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q923K4

Recommended name:tRNA modification GTPase GTPBP3, mitochondrial

EC number:

Alternative names:(GTP-binding protein 3)

Cleaved into:

GeneID:70359

Gene names  (primary ):Gtpbp3

Gene names  (synonym ):

Gene names  (ORF ):

Length:492

Mass:52175

Sequence:MWRGLSALVTQAAWAPLRLCARCSTSAESLVPSSTIFALSSGQGRCAIAVIRTSGPASGLALRSLTALQEPPPARRACLRLLRHPCSGEPLDRSLVLWFPGPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIRAETEAQRRQALRQLDGELSQLCQGWAKTLTKALAYVEAYIDFGEDDNLEEGVLEQADREVRALEVALGSHLRDARRGQRLLSGANVVVTGPPNAGKSSLVNLLSQKPVSIVSPEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGAVEQEGVRRARHRLEQADIILGVLDASDLASSSSCSFLDTVVTPLLAQSQDSGGQRLLLLLNKSDLLSANAPACDIALPPHLLLSCHTGAGMDSLLQALKTELAAVCGDPSTGPPLLTRVRHQYHLQGCLDALGHYQLATDLALAAEALRQARRQLNHLTGGGGTEEILDLIFQDFCVGK

Tissue specificity:Ubiquitously expressed. Highly expressed in tissues with high metabolic rates including heart, liver and brain. Weakly expressed in skeletal muscle. {ECO:0000269|PubMed:14680828}.

Induction:

Developmental stage:

Protein families:TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, TrmE GTPase family


   💬 WhatsApp