GRCR2_MOUSE   Q3TYR5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TYR5

Recommended name:Glutaredoxin domain-containing cysteine-rich protein 2

EC number:

Alternative names:(GRXCR1-like protein) (Glutaredoxin domain-containing cysteine-rich protein 1-like protein)

Cleaved into:

GeneID:332309

Gene names  (primary ):Grxcr2

Gene names  (synonym ):Gm851

Gene names  (ORF ):

Length:254

Mass:28601

Sequence:MEDSEKKLNQKSDDKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQEALEPMDGVYGSGEVPKPQPYSPKLTAQRISVFRDSGAYTLAGSQPLFNDYKANDHKPPPIIDFGKIIIYTNNLKIIRTPMDKRDFMRKILQKEDVAEEASLMITGENDGDREQGCPLPERNGSPLPESERTFLHSQHTQDGLVPEDCLHCQGSGIATCSLCHGSKFSMLANRFKESYRALRCPACNENGLQPCRICSP

Tissue specificity:Expressed in sensory hair cells in the cochlea and vestibular organ. {ECO:0000269|Ref.3}.

Induction:

Developmental stage:

Protein families:GRXCR1 family


   💬 WhatsApp