GRPR_MOUSE P21729
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21729
Recommended name：Gastrin-releasing peptide receptor
EC number：
Alternative names：(GRP-R) (GRP-preferring bombesin receptor)
Cleaved into：
GeneID：14829
Gene names (primary )：Grpr
Gene names (synonym )：
Gene names (ORF )：
Length：384
Mass：43215
Sequence：MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMTSFKSTNPSATFSLINRNICHEGYV
Tissue specificity：Detected in pancreas and brain (PubMed:1671171, PubMed:9345264). Detected in suprachaismatic nucleus neurons (PubMed:28280205). Detected in neurons in the dorsal horn of the spinal cord (PubMed:17653196). Detected in inhibitory GABAergic interneurons in the lateral nucleus of the amygdala (PubMed:12526815). {ECO:0000269|PubMed:12526815, ECO:0000269|PubMed:1671171, ECO:0000269|PubMed:17653196, ECO:0000269|PubMed:28280205, ECO:0000269|PubMed:9345264}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family