HCAR1_MOUSE Q8C131
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C131
Recommended name：Hydroxycarboxylic acid receptor 1
EC number：
Alternative names：(G-protein coupled receptor 81)
Cleaved into：
GeneID：243270
Gene names (primary )：Hcar1
Gene names (synonym )：Gpr81
Gene names (ORF )：
Length：343
Mass：38927
Sequence：MDNGSCCLIEGEPISQVMPPLLILVFVLGALGNGIALCGFCFHMKTWKSSTIYLFNLAVADFLLMICLPLRTDYYLRRRHWIFGDIACRLVLFKLAMNRAGSIVFLTVVAVDRYFKVVHPHHMVNAISNRTAAATACVLWTLVILGTVYLLMESHLCVQGTLSSCESFIMESANGWHDVMFQLEFFLPLTIILFCSVNVVWSLRRRQQLTRQARMRRATRFIMVVASVFITCYLPSVLARLYFLWTVPTSACDPSVHTALHVTLSFTYLNSMLDPLVYYFSSPSLPKFYTKLTICSLKPKRPGRTKTRRSEEMPISNLCSKSSIDGANRSQRPSDGQWDLQVC
Tissue specificity：Highly expressed in subcutaneous fat and omental fat and detectable in lower levels in brain and many other tissues. High levels detected in epididymal and subcutaneous fat with slightly lower in omental fat, low levels are detected in the brain, skeletal muscle, kidney, liver and the pancreas (at protein level). {ECO:0000269|PubMed:18174606, ECO:0000269|PubMed:19047060}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family