CD151_MOUSE   O35566


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35566

Recommended name:CD151 antigen

EC number:

Alternative names:(GP27) (Membrane glycoprotein SFA-1) (Platelet-endothelial tetraspan antigen 3) (PETA-3) (CD antigen CD151)

Cleaved into:

GeneID:12476

Gene names  (primary ):Cd151

Gene names  (synonym ):Peta3

Gene names  (ORF ):

Length:253

Mass:28246

Sequence:MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tetraspanin (TM4SF) family


   💬 WhatsApp