CTDS1_MOUSE   P58466


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P58466

Recommended name:Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

EC number:EC 3.1.3.16

Alternative names:(Golli-interacting protein) (GIP) (Nuclear LIM interactor-interacting factor 3) (NLI-interacting factor 3) (Small C-terminal domain phosphatase 1) (SCP1) (Small CTD phosphatase 1)

Cleaved into:

GeneID:227292

Gene names  (primary ):Ctdsp1

Gene names  (synonym ):Nif3 Nliif

Gene names  (ORF ):

Length:261

Mass:29266

Sequence:MDSSAVITQISKEEARGPLRGKGDQKSAVSQKPRSRGILHSLFCCVCRDDGEPLPAHSGAPLLVEENGAIPKHTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS

Tissue specificity:Expression is restricted to non-neuronal tissues. {ECO:0000269|PubMed:15681389}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp