QPCTL_MOUSE   Q8BH73


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BH73

Recommended name:Glutaminyl-peptide cyclotransferase-like protein

EC number:EC 2.3.2.5

Alternative names:(Golgi-resident glutaminyl-peptide cyclotransferase) (isoQC) (gQC)

Cleaved into:

GeneID:67369

Gene names  (primary ):Qpctl

Gene names  (synonym ):

Gene names  (ORF ):

Length:383

Mass:42692

Sequence:MSPGSRGRPRQRLEDRGLMKPPSLSKRRLLPRVQFLPLLLLALAMGLAFYIVWNSWHPGVEEMSRSRDLRVPLIGSLSEAKLRLVVGQLDPQRLWGTFLRPLLIVRPPGSSGNLQVRKFLEATLQSLSAGWHVELDPFTASTPLGPLDFGNVVATLDPGAARHLTLACHYDSKFFPPGLPPFVGATDSAVPCALLLELVQALDAMLSRIKQQAAPVTLQLLFLDGEEALKEWGPKDSLYGSRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGASSPIFFSHFPRTARWFQRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIATPFPAVWHTPADTEANLHPPTVHNLSRILAVFLAEYLGL

Tissue specificity:Detected in thalamus, hippocampus, brain cortex, cerebellum, kidney, lung and liver, and at low levels in heart and spleen. {ECO:0000269|PubMed:18486145}.

Induction:

Developmental stage:

Protein families:Glutaminyl-peptide cyclotransferase family


   💬 WhatsApp