S35A3_MOUSE   Q8R1T4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1T4

Recommended name:UDP-N-acetylglucosamine transporter

EC number:

Alternative names:(Golgi UDP-GlcNAc transporter) (Solute carrier family 35 member A3)

Cleaved into:

GeneID:229782

Gene names  (primary ):Slc35a3

Gene names  (synonym ):

Gene names  (ORF ):

Length:326

Mass:35976

Sequence:MSANLKYLSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAEFLKIMACIFLVYKDSKCSVRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLGKKLGVYQWLSLVILMAGVAFVQWPSDSQELNSKDLSTGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLGFFGSIFGLMGVYVYDGELVSKNGFFQGYNQLTWIVVALQALGGLVIAAVIKYADNILKGFATSLSIILSTIISYFWLQDFVPTSVFFLGAILVIAATFLYGYDPKPAGNPTKA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Nucleotide-sugar transporter family, SLC35A subfamily


   💬 WhatsApp