BET1L_MOUSE   O35153


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35153

Recommended name:BET1-like protein

EC number:

Alternative names:(Golgi SNARE with a size of 15 kDa) (GOS-15) (GS15) (Vesicle transport protein GOS15)

Cleaved into:

GeneID:54399

Gene names  (primary ):Bet1l

Gene names  (synonym ):Gs15

Gene names  (ORF ):

Length:111

Mass:12428

Sequence:MADWTRAQSSGAVEDILDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTMARSGRDNRKLLCGMAVVLIVAFFILSYLLSRTRT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp