LFG1_MOUSE   Q9ESF4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ESF4

Recommended name:Protein lifeguard 1

EC number:

Alternative names:(Glutamate [NMDA] receptor-associated protein 1) (NMDA receptor glutamate-binding subunit)

Cleaved into:

GeneID:66168

Gene names  (primary ):Grina

Gene names  (synonym ):Lag Lfg1 Nmdara1

Gene names  (ORF ):

Length:345

Mass:38408

Sequence:MSHEKSFLVSGDSYPPQNIVGPQAPMPPYVQAPYPGAPYPQAPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPPPFQDPGSPQHGNYQEEGPPSYYDNQDFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAIFFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE

Tissue specificity:

Induction:

Developmental stage:

Protein families:BI1 family, LFG subfamily


   💬 WhatsApp