GNPI1_MOUSE   O88958


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88958

Recommended name:Glucosamine-6-phosphate isomerase 1

EC number:EC 3.5.99.6

Alternative names:(Glucosamine-6-phosphate deaminase 1) (GNPDA 1) (GlcN6P deaminase 1) (Oscillin)

Cleaved into:

GeneID:26384

Gene names  (primary ):Gnpda1

Gene names  (synonym ):Gnpi

Gene names  (ORF ):

Length:289

Mass:32549

Sequence:MKLIILEHYSQASEWAAKYIRNRIIQFNPGPDKYFTLGLPTGSTPLGCYQKLIEYYKNGDLSFQYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAADLQAECDAFEEKIQAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGDLAKVPTMALTVGVGTVMDAKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKEIQKSQSAKKPYSD

Tissue specificity:Widely expressed. Detected in brain, liver, kidney, muscle, ovary, testis, spermatids and spermatozoa. In spermatids, located close to the developing acrosome vesicle. In spermatozoa, found close to the acrosomal region. {ECO:0000269|PubMed:10481053}.

Induction:

Developmental stage:

Protein families:Glucosamine/galactosamine-6-phosphate isomerase family


   💬 WhatsApp