GNPTG_MOUSE   Q6S5C2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6S5C2

Recommended name:N-acetylglucosamine-1-phosphotransferase subunit gamma

EC number:

Alternative names:(GlcNAc-1-phosphotransferase subunit gamma) (M6PR domain-containing protein 1) (UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma)

Cleaved into:

GeneID:214505

Gene names  (primary ):Gnptg

Gene names  (synonym ):Mdcp1

Gene names  (ORF ):

Length:307

Mass:34169

Sequence:MAGRLAGFLMLLGLASQGPAPAYAGKMKVVEEPNTFGLNNPFLPQASRLQPKREPSAVSGPLHLFRLAGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIINNTFKGMWMTDGDSCHSRSRQSKVELTCGKINRLAHVSEPSTCVYALTFETPLVCHPHSLLVYPTLSEALQQRWDQVEQDLADELITPQGYEKLLRVLFEDAGYLKVPGETHPTQLAGGSKGLGLETLDNCRKAHAELSQEVQRLTSLLQQHGIPHTQPTETTHSQHLGQQLPIGAIAAEHLRSDPGLRGNIL

Tissue specificity:Widely expressed. Highly expressed in the liver, intestine, brain, thymus, testis and ovary. {ECO:0000269|PubMed:15716021}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp