K1B24_MOUSE Q61754
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61754
Recommended name：Kallikrein 1-related peptidase b24
EC number：EC 3.4.21.35
Alternative names：(Glandular kallikrein K24) (mGK-24) (Tissue kallikrein 24)
Cleaved into：
GeneID：16617
Gene names (primary )：Klk1b24
Gene names (synonym )：Klk-24 Klk24
Gene names (ORF )：
Length：263
Mass：28926
Sequence：MWFLILFLALSLGGIDAAPPVQSRVVGGFKCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGNATSQYNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDDIPQPKDKSNDLMLLRLSEPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKWQKPNDLQCVFIKLLPNENCTKPYLHKVTDVMLCAGEMGGGKDTCAGDSGGPLICDGILHGITSWGPVPCGKPNAPAIYTKLIKFASWIKDTMAKNP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily