K1KB1_MOUSE P00755
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P00755
Recommended name：Kallikrein 1-related peptidase b1
EC number：EC 3.4.21.35
Alternative names：(Glandular kallikrein K1) (mGK-1) (Tissue kallikrein-1)
Cleaved into：
GeneID：16623
Gene names (primary )：Klk1b1
Gene names (synonym )：Klk-1 Klk1
Gene names (ORF )：
Length：261
Mass：29022
Sequence：MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYKEYICGGVLLDANWVLTAAHCYYEKNNVWLGKNNLYQDEPSAQHRLVSKSFLHPCYNMSLHRNRIQNPQDDYSYDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSIIPVKFQYAKDLQCVNLKLLPNEDCDKAYVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDGVLQGLTSWGYNPCGEPKKPGVYTKLIKFTSWIKDTLAQNP
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily