GCSAM_MOUSE Q6RFH4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6RFH4
Recommended name：Germinal center-associated signaling and motility protein
EC number：
Alternative names：(Germinal center B-cell-expressed transcript 2 protein)
Cleaved into：
GeneID：14525
Gene names (primary )：Gcsam
Gene names (synonym )：Gcet Gcet2 M17
Gene names (ORF )：
Length：181
Mass：20988
Sequence：MGNCLQRTTRWQLDMQETPWNLRLSAKGRTCRYFRGWSCCHSVEGCSCLPWKNIRTFKARQESPKQNEGMTSAPVQDNANETYTEELCYILVDHEAVRGRPSVNPAEGFYENISNKAERHKESSRGTETEYSVLRFPSPPQPLPSTDDEYELLMPSRFSSHAFQQPRPLTTPYETHFSYPQ
Tissue specificity：Highly expressed in normal germinal center (GC) B-cells. Expressed in spleen and, to a lesser extent, bone marrow. {ECO:0000269|PubMed:7981148, ECO:0000269|Ref.2}.
Induction：
Developmental stage：
Protein families：