K1B16_MOUSE P04071
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04071
Recommended name:Kallikrein 1-related peptidase b16
EC number:EC 3.4.21.54
Alternative names:(Gamma-renin, submandibular gland) (Glandular kallikrein K16) (mGK-16)
Cleaved into:
GeneID:16615
Gene names (primary ):Klk1b16
Gene names (synonym ):Klk-16 Klk16
Gene names (ORF ):
Length:261
Mass:28722
Sequence:MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWVLTAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSNDLMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKWQKPDDLQCMFTKLLPNENCAKAYLLKVTDVMLCTIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGIPGVSAIYTNLVKFNSWIKDTMMKNA
Tissue specificity:
Induction:
Developmental stage:
Protein families:Peptidase S1 family, Kallikrein subfamily