CHAC1_MOUSE   Q8R3J5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R3J5

Recommended name:Glutathione-specific gamma-glutamylcyclotransferase 1

EC number:EC 4.3.2.7

Alternative names:(Gamma-GCG 1) (Blocks Notch protein) (Botch) (Cation transport regulator-like protein 1)

Cleaved into:

GeneID:69065

Gene names  (primary ):Chac1

Gene names  (synonym ):Botch

Gene names  (ORF ):

Length:223

Mass:24547

Sequence:MKQESASQSTPPPSLSPAPSSAQPSWGDGDPQALWIFGYGSLVWKPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDREGCTWGVAYQVRGEQVNEALKYLNVREAVLGGYDTKEVTFYPQDTPDQPLTALAYVATPQNPGYLGPAPEEVIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLEAIVDAVGTLLPCSYLPEQPLALT

Tissue specificity:Widely expressed, with high expression in forebrain and anterior spinal cord. Expressed at intermediate level in the dorsal aorta and heart. Present throughout adult brain (at protein level). {ECO:0000269|PubMed:22445366}.

Induction:

Developmental stage:

Protein families:Gamma-glutamylcyclotransferase family, ChaC subfamily


   💬 WhatsApp