OSTR_MOUSE   P54615


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P54615

Recommended name:Osteocalcin-related protein

EC number:

Alternative names:(Gamma-carboxyglutamic acid-containing protein 3) (Nephrocalcin) (OC-X)

Cleaved into:

GeneID:12095

Gene names  (primary ):Bglap3

Gene names  (synonym ):Bglap-rs1

Gene names  (ORF ):

Length:95

Mass:10459

Sequence:MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI

Tissue specificity:Expressed in kidney and lung, but not in bone. {ECO:0000269|PubMed:8288580}.

Induction:

Developmental stage:

Protein families:Osteocalcin/matrix Gla protein family


   💬 WhatsApp