GBRL2_MOUSE   P60521


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P60521

Recommended name:Gamma-aminobutyric acid receptor-associated protein-like 2

EC number:

Alternative names:(GABA(A) receptor-associated protein-like 2) (Golgi-associated ATPase enhancer of 16 kDa) (GATE-16)

Cleaved into:

GeneID:93739

Gene names  (primary ):Gabarapl2

Gene names  (synonym ):

Gene names  (ORF ):

Length:117

Mass:13667

Sequence:MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Tissue specificity:Ubiquitous. A high level expression is seen in brain, thymus, lung, heart, liver and kidney. {ECO:0000269|PubMed:11414770}.

Induction:

Developmental stage:

Protein families:ATG8 family


   💬 WhatsApp