GBRL1_MOUSE   Q8R3R8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R3R8

Recommended name:Gamma-aminobutyric acid receptor-associated protein-like 1

EC number:

Alternative names:(GABA(A) receptor-associated protein-like 1) (Glandular epithelial cell protein 1) (GEC-1)

Cleaved into:

GeneID:57436

Gene names  (primary ):Gabarapl1

Gene names  (synonym ):Apg8l Atg8l Gec1

Gene names  (ORF ):MNCb-0091

Length:117

Mass:14044

Sequence:MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Tissue specificity:Expressed in testis and heart at high levels. {ECO:0000269|PubMed:11414770}.

Induction:

Developmental stage:

Protein families:ATG8 family


   💬 WhatsApp