GAST_MOUSE   P48757


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48757

Recommended name:Gastrin [Cleaved into: Gastrin-71

EC number:

Alternative names:(G71); Big gastrin (Gastrin-34) (G34); Gastrin]

Cleaved into:

GeneID:14459

Gene names  (primary ):Gast

Gene names  (synonym ):Gas

Gene names  (ORF ):

Length:101

Mass:11590

Sequence:MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEDQ

Tissue specificity:Abundantly expressed in the stomach and duodenum. Low levels in brain, ovary and pancreas. {ECO:0000269|PubMed:8647266}.

Induction:

Developmental stage:

Protein families:Gastrin/cholecystokinin family


   💬 WhatsApp