GNA15_MOUSE P30678
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30678
Recommended name：Guanine nucleotide-binding protein subunit alpha-15
EC number：
Alternative names：(G alpha-15) (G-protein subunit alpha-15)
Cleaved into：
GeneID：14676
Gene names (primary )：Gna15
Gene names (synonym )：Gna-15
Gene names (ORF )：
Length：374
Mass：43536
Sequence：MARSLTWGCCPWCLTEEEKTAARIDQEINRILLEQKKQEREELKLLLLGPGESGKSTFIKQMRIIHGVGYSEEDRRAFRLLIYQNIFVSMQAMIDAMDRLQIPFSRPDSKQHASLVMTQDPYKVSTFEKPYAVAMQYLWRDAGIRACYERRREFHLLDSAVYYLSHLERISEDSYIPTAQDVLRSRMPTTGINEYCFSVKKTKLRIVDVGGQRSERRKWIHCFENVIALIYLASLSEYDQCLEENDQENRMEESLALFSTILELPWFKSTSVILFLNKTDILEDKIHTSHLATYFPSFQGPRRDAEAAKSFILDMYARVYASCAEPQDGGRKGSRARRFFAHFTCATDTQSVRSVFKDVRDSVLARYLDEINLL
Tissue specificity：Expressed primarily in hematopoietic cells. Coexpressed with EDG6 at the same relative levels in all tissues examined, with the highest levels in adult spleen and lung. {ECO:0000269|PubMed:12401211}.
Induction：
Developmental stage：
Protein families：G-alpha family, G(q) subfamily