SRS10_MOUSE Q9R0U0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0U0
Recommended name：Serine/arginine-rich splicing factor 10
EC number：
Alternative names：(FUS-interacting serine-arginine-rich protein 1) (Neural-salient serine/arginine-rich protein) (Neural-specific SR protein) (Splicing factor, arginine/serine-rich 13A) (TLS-associated protein with Ser-Arg repeats) (TASR) (TLS-associated protein with SR repeats) (TLS-associated serine-arginine protein) (TLS-associated SR protein)
Cleaved into：
GeneID：14105
Gene names (primary )：Srsf10
Gene names (synonym )：Fusip1 Nssr Sfrs13a Srsf13a
Gene names (ORF )：
Length：262
Mass：31301
Sequence：MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
Tissue specificity：Widely expressed, with high levels in brain and testis. {ECO:0000269|PubMed:10583508}.
Induction：
Developmental stage：
Protein families：Splicing factor SR family