FOLR2_MOUSE   Q05685


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q05685

Recommended name:Folate receptor beta

EC number:

Alternative names:(FR-beta) (Folate receptor 2) (Folate-binding protein 2)

Cleaved into:

GeneID:14276

Gene names  (primary ):Folr2

Gene names  (synonym ):Fbp2 Folbp2

Gene names  (ORF ):

Length:251

Mass:28821

Sequence:MAWKQTPLLLLVYMVTTGSGRDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCSVNTSQELHKADSRLYFNWDHCGKMEPACKSHFIQDSCLYECSPNLGPWIQQVDQSWRKERFLDVPLCKEDCHQWWEACRTSFTCKRDWHKGWDWSSGINKCPNTAPCHTFEYYFPTPASLCEGLWSHSYKVSNYSRGSGRCIQMWFDSTQGNPNEDVVKFYASFMTSGTVPHAAVLLVPSLAPVLSLWLPG

Tissue specificity:

Induction:

Developmental stage:

Protein families:Folate receptor family