FOXF1_MOUSE Q61080
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61080
Recommended name：Forkhead box protein F1
EC number：
Alternative names：(Forkhead-related protein FKHL5) (Forkhead-related transcription factor 1) (FREAC-1) (Hepatocyte nuclear factor 3 forkhead homolog 8) (HFH-8)
Cleaved into：
GeneID：15227
Gene names (primary )：Foxf1
Gene names (synonym )：Fkhl5 Foxf1a Freac1 Hfh8
Gene names (ORF )：
Length：378
Mass：39958
Sequence：MSAPDKQQPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGSISTHSLEQPYLHQNSHNGPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHTTGGGSYYHQQVTYQDIKPCVM
Tissue specificity：Expressed primarily in lung in alveolar type II pneumocyte cells, and to a lesser extent in placenta, stomach, intestine and colon. {ECO:0000269|PubMed:11313147, ECO:0000269|PubMed:7958446}.
Induction：
Developmental stage：
Protein families：