FOXL1_MOUSE   Q64731


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64731

Recommended name:Forkhead box protein L1

EC number:

Alternative names:(Forkhead-related protein FKHL11) (Transcription factor FKH-6)

Cleaved into:

GeneID:14241

Gene names  (primary ):Foxl1

Gene names  (synonym ):Fkh6 Fkhl11

Gene names  (ORF ):

Length:336

Mass:35793

Sequence:MSHLFSPPLAALAASPLLYVYSPERPGLPLAFAPAAALAGPGRVEPPQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGSPEAKRTRVEPPESEVGCDVGSPDLATALPTRAPDRSQSPAVGTARPALLPWPGPEPRDPDADLTVQGAGAVASGQLQRPAHHLGSPLCPAPSGSPKGSKSKSFSIDSILAVRPTPASGAEAPGIPKPVPGALGSSLLAASSGLAPPFNASLVFDAHVQGGFSQLGIPFLSYFPLQVPEATVLRFH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp