GLMN_MOUSE   Q8BZM1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BZM1

Recommended name:Glomulin

EC number:

Alternative names:(FK506-binding protein-associated protein) (FAP) (FKBP-associated protein)

Cleaved into:

GeneID:170823

Gene names  (primary ):Glmn

Gene names  (synonym ):Fap48

Gene names  (ORF ):

Length:596

Mass:67756

Sequence:MAVEELQSIIKRCQILEEHDFKEEDFGLFQLAGQRCIEDGYINQLLEIIQDEKNKTIIKSMGWNLVGPVVRCLLRGREEDKREECFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQIILLLLQPLQTVIQKLPNNKAYSVGLALSTLWSQLSLLPVPHSEEQIQADDYGLCQCCKALIEFTKPFVEEVISDKENKENAKLKDELLKFCFKGLKCPLLTAQFLEQSEDVGNDPFRCFASEIIGFLSKIGHPVPQIILNHGRKKRTWDYLEFEEEEDKQLAESVASLTYLVFVQGIGIDQLPMVLSPSYLLQLNMEHIEVFLQRTEQSIYSKGLELLETSLLRLEDNSLCYQYLEIKSFLAVPQGLVKVMTLCPIETLRKKGLSMLQLFIDKLDSQGKYTLFRCLLNTSNHSGVEAFVIQNIKNQIDLSFKKTYNKWFAGAQLISLLDLVLSLPEGAETDLLQNSDRIMASLNLLRYLVIKDNEDDNQTGLWTELGKIENNFLKPLHIGLNMSKAHYEAEIKNSQQNNQVASMCKGVCSVTVGGEEIPSMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKSKSTSEENVGIK

Tissue specificity:Ubiquitous. Detected in embryonic vasculature and embryonic perichondrium, and in adult eye, brain, heart, testis, kidney, smooth muscle and skeletal muscle. {ECO:0000269|PubMed:15053987}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp