FHL5_MOUSE Q9WTX7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WTX7
Recommended name：Four and a half LIM domains protein 5
EC number：
Alternative names：(FHL-5) (Activator of cAMP-responsive element modulator in testis) (Activator of CREM in testis)
Cleaved into：
GeneID：57756
Gene names (primary )：Fhl5
Gene names (synonym )：Act
Gene names (ORF )：
Length：284
Mass：32907
Sequence：MTSSQFDCQYCTSSLIGKKYVLKDDNLYCISCYDRIFSNYCEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDDRLLCTDCYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFRDQIWHKECFLCSGCRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPITGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKCGSGADTDA
Tissue specificity：Testis-specific, temporal expression is coordinated with CREM. {ECO:0000269|PubMed:10086359}.
Induction：
Developmental stage：
Protein families：