CEP43_MOUSE   Q66JX5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q66JX5

Recommended name:Centrosomal protein 43

EC number:

Alternative names:(FGFR1 oncogene partner)

Cleaved into:

GeneID:75296

Gene names  (primary ):Cep43

Gene names  (synonym ):Fgfr1op

Gene names  (ORF ):

Length:399

Mass:42758

Sequence:MAATTAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNENLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPETSTIQGLEGRENLAQDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPASVEGALDLSDGHPPSKSPEGKSSANSTPSKIPRYKGQGKKKTIGQKPGDKKTSSETSQSEPSVSLSESKSKSSLHSLAHETRIASFLSSSAVDARDSSALCPDGDDVEGDSFFDDPIPKPEKTYGWRAEPRKQVGGLASLSDKPHLRSGLSSLAGAPSLTDPESKRGSTVLKDLKLVGEKIGSLGLGTGEDEDYADDFNSASHRSEKSELSIGEEIEEDLSMGVEDGNTSDKLDDLTQDLTVSQLSDVADYLEDVA

Tissue specificity:

Induction:

Developmental stage:

Protein families:CEP43 family


   💬 WhatsApp