FGF12_MOUSE P61329
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61329
Recommended name：Fibroblast growth factor 12
EC number：
Alternative names：(FGF-12) (Fibroblast growth factor homologous factor 1) (FHF-1) (Myocyte-activating factor)
Cleaved into：
GeneID：14167
Gene names (primary )：Fgf12
Gene names (synonym )：Fhf1
Gene names (ORF )：
Length：243
Mass：27399
Sequence：MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Tissue specificity：
Induction：
Developmental stage：
Protein families：Heparin-binding growth factors family